Variant annotation tutorial
Code and tutorials for CIHEAM course. Variation annotation and function prediction sessions
Slicing and dicing of VCF files
VCF files can get very big. Being able to manipulate them and extract relevant information is important. In practice, flat text files such as VCF are currently the basis for further analysis - see the Imputation and Population practical sessions.
The first task involves selecting all called variants of chromosome 18, bgzip-ping them on-the-fly, and then indexing that file with tabix:
tabix -h allbt.vcf.gz 18 | bgzip >BT18.vcf.gz tabix -p vcf BT18.vcf.gz
Annotating VCF with rs-numbers
The VCF file you are working does not yet have the dbSNP identifiers (rs-numbers) annotated. The rs-numbers of all currently known variants as databased in dbSNP can be found in this file:
/path/to/ BT18.vcf.gz
Have a look at what is inside this file:
gunzip -c BT18.vcf.gz | grep -v '^##' | more
or
tabix BT18.vcf.gz 18:1-10000 | more
You can use vcftools to do many things related to VCF files. This includes annotating the VCF based on other interval-file formatted input, including other VCF files. For instance, you can annotate an interval of the VCF on the fly, by selecting that interval using tabix, and then piping it to vcf-annotate, like so:
tabix -h BT18.vcf.gz 18:100000-101000 | vcf-annotate -a BT_incl_cons.18.vcf.gz -c CHROM,FROM,ID
Now make a new VCF file for all the variants called for chromosome 18 using this tool:
tabix -h BT18.vcf.gz 18 | vcf-annotate -a BT_incl_cons.18.vcf.gz -c CHROM,FROM,ID | bgzip >BT18_rsnumbers.vcf.gz tabix -p vcf BT18_rsnumbers.vcf.gz
Extracting variants using BEDtools
You will very often want to extract variants based on interval files, e.g. a certain region on a chromosome. This can be easily achieve using the tabix command described above. However, sometimes you may want to extract a substantial number of intervals. You could use tabix in a loop, either as a shell-script or in a scripting language like Perl or Python. However, BedTools provides many utilities for manipulating interval data, such as BED, VCF, or GTF/GFF formats.
Say you are interested in the variants in all the genes lying between coordinates 1,000,000 and 2,000,000 on chromosome 18. The annotation of genes can be found in a GTF file. The GTF file for the UMD3.1 genome build can be found at Ensembl and downloaded using the command line (NOTE: the compute nodes you are working on do not have internet connectivity. This line of code is just for completeness):
wget ftp://ftp.ensembl.org/pub/release-78/gtf/bos_taurus/Bos_taurus.UMD3.1.78.gtf.gz
The file is already downloaded and can be found here:
/path/to/Bos_taurus.UMD3.1.78.gtf.gz
Have a quick look at what is in this file:
gunzip -c /path/to/Bos_taurus.UMD3.1.78.gtf.gz | more
Familiarise yourself with the GTF format if you have not already. For more information:
http://www.ensembl.org/info/website/upload/gff.html
You can select the appropriate region from the GTF file:
gunzip -c Bos_taurus.UMD3.1.78.gtf.gz | awk '$3=="gene"' | awk '$1==18&&$4>1000000&&$4<2000000' >mygenes.gtf
Subsequently you can intersect the VCF with the GTF file that contains just the genes between coordinates 1 and 2 million:
bedtools intersect -a BT18_rsnumbers.vcf.gz -b mygenes.gtf >intersection_genes.vcf
Have a quick look at the output, and count the number of variants in this VCF (e.g. by using 'wc -l').
Now do the same, but select only the exonic variants in the same interval, from 1 to 2 million.
How many variants do you have now?
Variant Effect Predictor
Various tools exist to make more precise annotations than what you can achieve using Bedtools and a GTF. Among them are Variant Effect Predictor (VEP), snpEff, and Annovar. For the current practical we will use former two.
VEP uses a cache directory that has the annotation information. On the infrastructure you are working on that directory can be found here:
/home/formacion/COMUNES/IAMZ/data/CIHEAM/ReferenceGenome/VEP/
You can create a file that will provide annotation information for each SNP:
gunzip -c BT18_rsnumbers.vcf.gz | perl /home/formacion/COMUNES/IAMZ/soft/ensembl-tools-release-78/scripts/variant_effect_predictor/variant_effect_predictor.pl --dir /home/formacion/COMUNES/IAMZ/data/CIHEAM/ReferenceGenome/VEP/ --species bos_taurus -o BT18.vep --fork 4 --canonical --sift b --coding_only --no_intergenic --offline --force_overwrite
Have a look inside the output file and study its content. Why are there no SNPs in this list that are intergenic?
For some purposes, it might be more convenient to have the annotations directly in the VCF. You could for instance do the following:
gunzip -c BT18_rsnumbers.vcf.gz | perl /home/formacion/COMUNES/IAMZ/soft/ensembl-tools-release-78/scripts/variant_effect_predictor/variant_effect_predictor.pl --dir /home/formacion/COMUNES/IAMZ/data/CIHEAM/ReferenceGenome/VEP/ --species bos_taurus -o BT18.vep.vcf --fork 4 --canonical --sift b --coding_only --offline --force_overwrite --vcf bgzip BT18.vep.vcf tabix -p vcf BT18.vep.vcf.gz
Again, study and interpret your outcome by looking inside the file. Specifically, note WHERE the annotation ended up.
When dealing with deleterious alleles, we might be interested to learn how frequent that allele is in the population we are studying. Our expectation is that genuinly deleterious alleles should be relatively rare in a population. If not they might hint at either a sign of inbreeding, or, perhaps, something that might be deleterious in the wild but advantageous in the context of domestication/breeding. The VCF file holds the (reference) allele frequency information. The 8th column of the VCF file in fact is a bunch of fields concatenated with the ';' delimitor. One of the fields has the tag 'AF=', where AF stands for Allele Frequency. We can expand the number of space-delimited fields easily and then look for the 11th column. We need to remove the 'AF=' tag though, but if we do that we can further select for instance for allele frequencies between 0 and 15%.
gunzip -c BT18.vep.vcf.gz | grep deleterious | sed 's/;/\t/g' | awk '{gsub("AF=","",$11); print}' | awk '$11<0.15&&$11>0' | wc -l
Analysing the annotations a bit further, you could discover that some
gunzip -c BT18.vep.vcf.gz | grep deleterious | sed 's/;/ /g' | awk '{gsub("AF=","",$11); print}' | awk '$11<1&&$11>0' | sed 's/ /#_#/g' | sed 's/|/\t/g' | cut -f2 | sort | uniq -c | sed 's/^ \+//' | awk '$1>1' >genes_with_more_than1.txt
Take two or three genes that have the highest number of deleterious variants. Manually look them up at the Ensembl website (ensembl.org). Check the 'orthologous' status. What do you observe? How would you interpret the validity of the gene annotation and/or the likelihood of off-site mapping of reads?
This provides us with a strategy to filter a bit more rigorously for genes that may actually contain genuine deleterious alleles. Ideally we would a priory filter for genes that have proper one-to-one orthologous relations with other mammalian species. Time and lack of direct internet connection makes that unfeasible for this practical. However, genes that have only one deleterious variant segregating in the study population at a low frequency would certainly be better candidates than genes that have multiple deleterious variants, as the above example indicates. To filter you can do the following:
gunzip -c BT18.vep.vcf.gz | grep deleterious | sed 's/;/ /g' | awk '{gsub("AF=","",$11); print}' | awk '$11<0.15&&$11>0' | sed 's/ /#_#/g' | sed 's/|/\t/g' | cut -f2 | sort | uniq -c | sed 's/^ \+//' | awk '$1==1' | awk '{print $2}' >genes_with1.txt
How many genes are there that meet this condition?
snpEff
java -Xmx4G -jar $snpEff -dataDir ~/snpEff/data -v UMD3.1.78 sample_Bt.vcf >testresult_Bt.txt
Inferring function
from VEP output to Polyphen/Provean input
extracting fasta record.
faOneRecord Bos_taurus.UMD3.1.pep.all.fa `cat Bos_taurus.UMD3.1.pep.all.fa | grep ENSBTAT00000063226 | awk '{print $1}' | sed 's/>//'`
Provean
>ENSSSCP00000018263 pep:novel chromosome:Sscrofa10.2:12:6621092:6624938:1 gene:ENSSSCG00000017236 transcript:ENSSSCT00000018765 gene_biotype:protein_coding t transcript_biotype:protein_coding MTPRVGAVWLPSALLLLRVPGCLSLSGPPTAMGTKGGSLSVQCRYEEEYIDDKKYWDKSP CFLSWKHIVETTESAREVRRGRVSIRDDPANLTFTVTLERLTEEDAGTYCCGITAQFSVD PTHEVEVVVFPALGTSRPPSMPGPPTTLPATTWSFVSERETMANNLGKGPASQDPGQHPR SKHPSIRLLLLVFLEVPLFLGMLGAVLWVHRPLRSSESRSVAMDPVPGNTAPSAGWK
235,G,E 5,V,A 22,C,Y 34,T,I 51,D,N 53,K,N 59,S,Y 61,C,R 64,S,L 67,H,P 68,I,T 75,A,V 108,T,K 115,A,T 124,E,D 130,F,Y 133,L,P 142,P,A 155,F,I 158,E,G 186,I,V 21,G,D
## PROVEAN scores ## # VARIATION SCORE 235,G,E 0.076 5,V,A 0.287 22,C,Y -8.028 34,T,I -1.932 51,D,N -1.613 53,K,N 1.565 59,S,Y -2.140 61,C,R -5.826 64,S,L -0.437 67,H,P -0.511 68,I,T -2.664 75,A,V -1.061 108,T,K -4.051 115,A,T 1.557 124,E,D -1.587 130,F,Y -0.983 133,L,P 3.203 142,P,A -2.058 155,F,I 0.502 158,E,G -0.077 186,I,V 0.220 21,G,D -6.014
At the end of the VEP exercise we created a filtered list of genes that have only a single deleterious variant annotated. Among these genes was BLOC1S3 gene, ENSBTAG00000007070.
http://www.ensembl.org/Bos_taurus/Gene/Summary?db=core;g=ENSBTAG00000007070;r=18:53231599-53232201;t=ENSBTAT00000009293
GENE=ENSBTAG00000007070 PROT=`cat ~/Bos_taurus.UMD3.1.pep.all.fa | grep $GENE | awk '{print $1}' | sed 's/>//'` cat test.vep | grep $GENE | grep missense | awk '{print $10","$11}' | sed 's/\//,/' >$PROT.var
provean.sh -q $PROT.fa -v $PROT.var --save_supporting_set $PROT.sss >$PROT.result.txt 2>$PROT.error;
faOneRecord ~/Bos_taurus.UMD3.1.pep.all.fa $PROT >$PROT.fa
cat ENSBTAG00000007070.fa >>ENSBTAG00000007070.sss.fasta mafft --auto ENSBTAG00000007070.sss.fasta >ENSBTAG00000007070.sss.fasta.out
Transfer the alignment to your local environment and view (seaview?). What do you observe for the 26th amino-acid of the cow protein sequence? In this 'implicit evolutionary context' there is one alternative amino acid that occurs at this site. What do the D amino acid and this evolutionary viable alternative share in terms of properties?
Through the orthology with human, try to find some possible phenotypic consequences of the alternative allele (e.g. through OMIM). Could there be a reason that the variant is at a relatively high frequency in this cattle population?
Polyphen
/lustre/nobackup/WUR/ABGC/shared/public_data_store/polyphen/polyphen-2.2.2/bin/run_pph.pl -s test1033.fa test1033.coord #o_acc o_pos o_aa1 o_aa2 rsid acc pos aa1 aa2 nt1 nt2 prediction based_on effect site region PHAT dScore Score1 Score2 MSAv Nobs Nstruct Nfilt PDB_id PDB_pos PDB_ch ident lengthNormASA SecStr MapReg dVol dProp B-fact H-bonds AveNHet MinDHet AveNInt MinDInt AveNSit MinDSit Transv CodPos CpG MinDJxn PfamHit IdPmax IdPSNP IdQmin ENSSSCG00000001099ENSSSCT00000001195 368 S A ENSSSCG00000001099ENSSSCT00000001195 368 S A benign alignment +0.721 -1.180 -1.901 2 68 12.350 12.350 42.63 ENSSSCG00000001099ENSSSCT00000001195 453 R H ENSSSCG00000001099ENSSSCT00000001195 453 R H benign alignment +0.351 -2.130 -2.481 2 67 33.194 33.194 93.76 ENSSSCG00000001099ENSSSCT00000001195 431 K T ENSSSCG00000001099ENSSSCT00000001195 431 K T possibly damaging alignment +1.705 -1.678 -3.383 2 68 2.382 68.80
What goes in:
test1033.fa >ENSSSCG00000001099ENSSSCT00000001195 MSSIEQTTEILLCLSPAEAANLKEGINFVRNKSTGKDYILFKNKSRLKACKNMCKHQGGL FIKDIEDLNGRSVKCTKHNWKLDVSSMKYINPPGSFCQDELVVEKDEENGVLLLELNPPN PWDSEPRSPEDLAFGEVQITYLTHACMDLKLGDKRMVFDPWLIGPAFARGWWLLHEPPSD WLERLSRADLIYISHMHSDHLSYPTLKKLAERRPDVPIYVGNTERPVFWNLNQSGVQLTN INVVPFGIWQQVDKNLRFMILMDGVHPEMDTCIIVEYKGHKILNTVDCTRPNGGRLPMKV ALMMSDFAGGASGFPMTFSGGKFTEEWKAQFIKTERKKLLNYKARLVKDLQPRIYCPFAG YFVESHPSDKYIKETNIKNDPNELNNLIKKNSEVVTWTPRPGATLDLGRMLKDPTDSKGI VEPPEGTKIYKDSWDFGPYLNILNAAIGDEIFRHSSWIKEYFTWAGFKDYNLVVRMIETD EDFSPLPGGYDYLVDFLDLSFPKERPSREHPYEEIRSRVDVIRHVVKNGLLWDDLYIGFQ TRLQRDPDIYHHLFWNHFQIKLPLTPPDWKSFLMCSG
test1033.coord ENSSSCG00000001099ENSSSCT00000001195 368 S A ENSSSCG00000001099ENSSSCT00000001195 453 R H ENSSSCG00000001099ENSSSCT00000001195 431 K T